PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA020297-PA
Common NameOsI_20845
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 310aa    MW: 33464 Da    PI: 5.0532
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA020297-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.87.9e-161663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEd++l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  BGIOSGA020297-PA 16 KGLWSPEEDDKLYNHIIRHGVGCWSSVPKLAGLQRCGKSCRLRWINYL 63
                      678*******************************************97 PP

2Myb_DNA-binding52.61.1e-1669113147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+++++E++l+v +++ lG++ W+ Ia++++ gRt++++k++w++ 
  BGIOSGA020297-PA  69 RGSFSQQEEDLIVALHEILGNR-WSQIASHLP-GRTDNEIKNFWNSC 113
                       899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-231166IPR009057Homeodomain-like
PROSITE profilePS5129415.9411163IPR017930Myb domain
SuperFamilySSF466891.88E-2814110IPR009057Homeodomain-like
SMARTSM007175.5E-121565IPR001005SANT/Myb domain
PfamPF002491.7E-141663IPR001005SANT/Myb domain
CDDcd001675.63E-111963No hitNo description
PROSITE profilePS5129426.03864118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2667118IPR009057Homeodomain-like
SMARTSM007172.5E-1668116IPR001005SANT/Myb domain
PfamPF002496.5E-1569113IPR001005SANT/Myb domain
CDDcd001671.49E-1171111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRLSSCGGV QAKLRKGLWS PEEDDKLYNH IIRHGVGCWS SVPKLAGLQR CGKSCRLRWI  60
NYLRPDLKRG SFSQQEEDLI VALHEILGNR WSQIASHLPG RTDNEIKNFW NSCLKKKLRQ  120
RGLDPATHKP IAAAAAAATS SESAVTQVDE DHKPHGAAAA AADGLAANAK QSVFDPFPVT  180
DFGAGFDLGA ANMAAALYGS HPDDGAGFVA DYSSVLDVSE NLGYGESSSN SSNWTCAEVS  240
NVLDSEVLNW AASAGADAAA KAEPFADMEQ QHSGYGGEYQ VEDDATLEHK FSLPCHEQSL  300
AQFDFNLEYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141185108B-MYB
1h8a_C1e-271411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113119LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.486080.0callus| seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8377890.0CT837789.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN047M16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638185.10.0PREDICTED: myb-related protein Hv33
SwissprotP200271e-122MYB3_HORVU; Myb-related protein Hv33
TrEMBLB8AW850.0B8AW85_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA020297-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-75myb domain protein 86